Description
LL-37 Peptide – Antimicrobial Defense & Immune Support
LL-37 is a naturally occurring antimicrobial peptide derived from human cathelicidin (hCAP18). It plays a vital role in the innate immune system, acting as a first-line defense against bacterial, viral, and fungal infections. LL-37 is known for its ability to neutralize pathogens, regulate immune responses, and promote wound healing and tissue regeneration.
How LL-37 Works
LL-37 functions by disrupting microbial membranes, making it an effective broad-spectrum antimicrobial agent. Additionally, it exhibits anti-inflammatory and immunomodulatory properties, helping to balance immune responses while preventing excessive inflammation. Research suggests LL-37 may also contribute to tissue repair and wound healing, making it a promising candidate for regenerative medicine applications.
Potential Benefits of LL-37 Peptide
✅ Broad-Spectrum Antimicrobial Action – Effective against bacteria, viruses, and fungi
✅ Supports Immune System Function – Modulates immune responses and reduces excessive inflammation
✅ Promotes Wound Healing – Enhances tissue repair and regeneration
✅ Gut Health & Autoimmune Support – May aid in conditions like inflammatory bowel disease (IBD)
✅ Skin & Respiratory Health – Potential applications in conditions such as psoriasis and chronic infections
Applications of LL-37 Peptide
LL-37 is currently being studied for its potential in treating infections, autoimmune diseases, and inflammatory conditions. Research also explores its effectiveness in wound healing, respiratory infections, and gut health support.
High-Purity & Lab-Tested
Our LL-37 peptide is produced under strict quality control standards, ensuring high purity and efficacy. It is synthetically manufactured for research purposes only and is not intended for human consumption.
Product Information
- Molecular Formula: C147H228N42O22
- Molecular Weight: 4493.27 g/mol
- Sequence: [LL-37, 37 aa]
- Purity: >98% (HPLC verified)
- Form: Lyophilized powder
